DPCstruct | MC9130
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 349 ± 45 aa |
| Standard deviation of domain lengths | 45.04 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 25.20 |
| Pfam Score | 63.46 |
| Assigned Pfam label(s) | PF15458- PF07842 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V4AFI7 | 3-304 | YDRLQTEVEDGEKEIEDCQDKIPQLEKQYKFYQEIRGYVRDLVECLNEKVPVINDFENRMKTMLRQQADLLIQRRQQDVRDQCQDYM… |
| A0A674P6G0 | 28-386 | AQAAKPAVQTDNGSIHYGAAVSDLSPVSIDLVKKRLQDRLGHMYAGHNANTEHYKQIEEDLAASEGSIQQLEGSSTDKADQYKFLQE… |
| K7MTN3 | 3-261 | None |
| A0A0B2VU31 | 249-618 | None |
| A0A7R9DNK3 | 1-245 | None |
| A0A2W1BYA0 | 2-394 | None |
| F4PRL5 | 473-770 | None |
| S7REZ7 | 232-608 | None |
| A0A7E5VEA5 | 4-362 | None |
| A0A804NQ93 | 70-465 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.