DPCstruct | MC9128
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 108 ± 6 aa |
| Standard deviation of domain lengths | 6.43 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 94.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 42.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9WC62 | 1-113 | MNTLSLEPYGVLKWVVVDREEELFELDDVLDEDKVIQALWYRWIFLNRNKFVANYFNGTKSFITENWQMIQKGAGLLALRTWLLVLC… |
| A0A2H3BIN9 | 560-667 | QTLDMRPFGVLAWTIIEREEEIFESDDIKDEHKVMHALWARWILLNRSKFIADYCRGITEFVDEYWPIIHKAAGWKALRFWLMTMLA… |
| A0A5N5QEL6 | 765-881 | None |
| A0A1C7MNH0 | 461-569 | None |
| S7Q0W9 | 1-100 | None |
| A0A4Y7QID8 | 228-335 | None |
| B8P452 | 252-350 | None |
| A0A1Y2J5X7 | 394-502 | None |
| A0A0K6GHV9 | 444-560 | None |
| A0A0C3PBC4 | 108-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.