DPCstruct | MC9125
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 125 ± 8 aa |
| Standard deviation of domain lengths | 7.79 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C2T6U8 | 1-124 | MPRRPATPPIDDGAKYLTVVYPYPSRPNMEFESHRKLFAQWVAACIGSEYLRAFYHKPTSPGSIIMEIEESLPDFQQILGAHQWSQF… |
| A0A0C9W803 | 1-134 | MPGKPKSGPPYTDTPPGSYIVITNPWGMSHNIRDRSQLDANRVAAWAQLVLKEATGSGRVPSVECVYGMGTRDEIIVQFPQGTDIAP… |
| A0A4Y9ZYT1 | 1-115 | None |
| M5G782 | 1-126 | None |
| S7Q5E1 | 1-129 | None |
| A0A165QHR3 | 1-125 | None |
| A0A4R0RUV6 | 10-123 | None |
| A0A4Y9XVY1 | 1-116 | None |
| A0A166BM73 | 1-125 | None |
| A0A0C3ANG1 | 1-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.