DPCstruct | MC9124
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 207 ± 18 aa |
| Standard deviation of domain lengths | 17.81 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13934 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9W754 | 6-210 | IFDVLLIRGGIRNPDALFPPVDPAGIKRLLQAILRSTYDALKKDCLVYILLKWAGEGRETSPGSRRFAEERCIPPQFVALADAYWLL… |
| A0A5C3MYB8 | 39-227 | ARDPWAYFNCPPESFPWSPSRREEIEMRRAKLSDNLLFDLLLRMGSVADPGSLYPPADLDALHRLLEAIDHTSYDTLKRDCLYYYLL… |
| A0A6G1P5W5 | 18-194 | None |
| A0A163CUH4 | 16-228 | None |
| A0A5N6THL1 | 21-223 | None |
| A0A177W9X4 | 928-1123 | None |
| A0A397U7U5 | 228-403 | None |
| A0A0C2WT27 | 12-223 | None |
| A0A364MSK0 | 19-239 | None |
| K5X2G3 | 319-514 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.