DPCstruct | MC9123
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 202 ± 19 aa |
| Standard deviation of domain lengths | 18.92 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 36.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF02580- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7SE95 | 152-333 | TMAPTTLVGLLVVLAQRKTLNGVQTLRKAPSGLSPSTSLDHIQQITHPDIIRRIIKISHQRLHARMIAGNYRAKEPSDTKDTLTACV… |
| A0A0C9VTS3 | 1-187 | MDPPLYLAEESVLGPTALARLLVVLAQRQTLDTIQGLKKAPSGLSSSTSLNHIQQITHPDIIRRFLTIALERVRAATAKGRERVRKE… |
| R7SE96 | 276-508 | None |
| R7SE55 | 3-212 | None |
| A0A5M3N069 | 34-260 | None |
| A0A5M3MX22 | 363-544 | None |
| A0A4R0RQR6 | 1047-1231 | None |
| A0A5M3M9D1 | 653-839 | None |
| A0A4Y7RXZ8 | 2-215 | None |
| A0A4S4MMA7 | 36-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.