DPCstruct | MC9122
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 186 ± 30 aa |
| Standard deviation of domain lengths | 29.96 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q2DKV5 | 2-166 | VRKVLQENAHASPHGWRTHEIYSLALKEKAPDGFQSTVKTHNGQAKPPHLEHPIRSKSFLKEILAHMRGYRDVKIVREVRESSSSSA… |
| A0A0C9V740 | 3-200 | SIRSSFQLFPRHATHGAREIVLNIIKTAKGPMSTKEVYDLAIKRTGTKFAKVEPLQDIKSLLEAKRAAGIKIPRKLPPHPNHEIRSI… |
| G4TDJ6 | 19-195 | None |
| A0A4S8MX52 | 1-223 | None |
| A0A284RD78 | 11-199 | None |
| A0A0H2RRF7 | 1-127 | None |
| A0A0J0XWP5 | 3-282 | None |
| A0A284RKM5 | 1-159 | None |
| A0A4S4M3H6 | 627-831 | None |
| A0A1C7M0M6 | 159-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.