DPCstruct | MC9121
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 120 ± 19 aa |
| Standard deviation of domain lengths | 18.53 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1HBC8 | 2-115 | DHIVPWHAAYRSTQILTGKKRFVLGASGHIAGVINPPPKPGKPPKRSHWIAKGAALPADPEAWLQSAVEHPGSWWPDWSAWLASHAG… |
| A0A2N2SN52 | 92-213 | ITQPLYVVAAEDDHIAPWLQTFRVINHVTGPKRYVLSSSGHILGIINPVVTPPKRKFWAGEAHRSDTAEQWRNRTEEQAGSWWTDWM… |
| A0A1Q8JH04 | 62-210 | None |
| A0A558HWZ0 | 474-610 | None |
| A0A833CZC9 | 41-169 | None |
| A0A7Y6Z2B3 | 9-130 | None |
| A0A060NNB7 | 470-613 | None |
| A0A535L4E1 | 2-95 | None |
| A0A5C7YGZ7 | 14-138 | None |
| A0A2S1XU24 | 95-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.