DPCstruct | MC9120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 124 ± 17 aa |
| Standard deviation of domain lengths | 16.85 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 21.79 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | PF13682- PF00015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N2S381 | 29-157 | IARQLAGTMQDASVRSFAELAKLDHLIFKLDVYQAVSGHSGRTAADFSSHHECRLGKWYFEGDGKRFANLPAYRNLDAPHALVHAAG… |
| A0A4U0PWV9 | 1-114 | MDLYQAIKAHGEWRWKFRMAIGKGDRLDTHSISSDDRCPLGQWLHSEGKRHYANLPAYTECLHQHAVFHREAAKVAQTINAQRYDDA… |
| A0A7W8DFL3 | 709-845 | None |
| A0A522UVS7 | 827-935 | None |
| A6Q9W1 | 761-864 | None |
| A0A5C5ZAU6 | 1-87 | None |
| A0A831W6T3 | 54-144 | None |
| A0A1G3H7Q6 | 30-152 | None |
| A0A336QTG4 | 125-241 | None |
| A0A2C9A4J7 | 1-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.