DPCstruct | MC912
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 78 ± 10 aa |
| Standard deviation of domain lengths | 10.24 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 26.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A413WE67 | 1-65 | MKIINQKVEHKKFGYGTIFALKDNKVYVKFGKIFGDRFFAYPDIFASDMIMCNEDLQEEILEEIG |
| A0A3B8U1F4 | 6-83 | LEGMNVEHSQYGHGIVNDQTDAVLTIEYADGVRKQKLPFVIASGCVKVNDTEATESCKRISDLDNEQAKLRKEIQYKE |
| A0A351IY68 | 2-88 | None |
| A0A1V5XXX0 | 3-85 | None |
| A0A133Y9L8 | 2-72 | None |
| A0A061AA53 | 8-73 | None |
| D9SUF9 | 1-88 | None |
| A0A1E4LF58 | 3-80 | None |
| A0A3C0ZUY7 | 55-121 | None |
| A0A7C6GRW3 | 3-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.