DPCstruct | MC9113
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 153 ± 33 aa |
| Standard deviation of domain lengths | 33.07 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 84.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.67 |
| Pfam Score | 80.16 |
| Assigned Pfam label(s) | PF21680- CL0003- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1ZCZ2 | 3-90 | LPETVREQLEIQIKYKGYIERQLEQVARAARLESTTIPADMDYSTVPSLSAEVREKLVRFRPDTLGQASRIPGVTPAGITILSIALKA |
| A0A2F0A3B1 | 141-290 | GSQFGLIDEERLKLTLEKKESFLDAQAFCRKKNLDGIKMDEWFRKPGNGISKLPLEIEKLYTNEVWNLIEIEFQNEGYIARQEQMIA… |
| A0A7V1P3D0 | 248-416 | None |
| A0A2R7RR01 | 7-119 | None |
| A0A4T0K8H8 | 396-587 | None |
| A0A834AQK3 | 134-316 | None |
| B9HEY2 | 16-151 | None |
| A0A2H2I8C0 | 25-196 | None |
| A0A7S1NPD8 | 678-849 | None |
| A0A7S0PT19 | 58-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.