DPCstruct | MC911
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 102 ± 10 aa |
| Standard deviation of domain lengths | 10.26 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B8U141 | 1-121 | MIRRNITKSYNLNIMSSLSTIKVGSKRIPYSLYYFSCNLDHFIHNNANLDPRLKCSLADAYARMYYGRPEAYMEEMISDQGSLKGMN… |
| A0A1Q6E1L2 | 119-229 | AERNAKKSEALKRLSSIKELTSKQRKVPIRTFFLSRNLEHALSGEPGECSNDEKELLAHRFARKYVNDIEGFRRFLSEEIGVAGDYS… |
| A0A645FW83 | 70-166 | None |
| A0A353MRA9 | 1-100 | None |
| A0A143Y499 | 42-148 | None |
| A0A151ASX6 | 16-122 | None |
| R9ML01 | 1-89 | None |
| D6E893 | 3-103 | None |
| A0A1T4PM21 | 50-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.