DPCstruct | MC9104
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 167 ± 16 aa |
| Standard deviation of domain lengths | 16.43 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D3IGB5 | 15-179 | VAGKAPWFGKDKWRRKYSEGPIVYRGVVAAQSELYKPGHKVGEAFHAITIVAVDKAHQCNEEWMQRVIKQLQDMQAGKVAVPSDCAE… |
| A0A5S9F2N1 | 27-190 | IDGYLKIDEPYIEEDDLKTFFSAYENLLQNGVVVWGHLIQANFELYSSGKCDRPGEVVYCKNPLLRCDVGRLEWIAAEIFNLKGTTP… |
| A0A4V0HWD7 | 46-228 | None |
| A0A355UWJ4 | 18-190 | None |
| A0A1V4GZC5 | 568-740 | None |
| A0A7T9EAG7 | 62-227 | None |
| A0A142X1I4 | 21-168 | None |
| A0A4Y3KDV6 | 17-176 | None |
| A0A2S8F9I5 | 27-192 | None |
| A0A0L6JK72 | 21-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.