DPCstruct | MC9102
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 76 ± 10 aa |
| Standard deviation of domain lengths | 10.06 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 49.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A140K604 | 1-54 | MNKKQLEQLINVIINGKYSWACVLVLRFYGRNPLDYIPYRTYYRLIRDNDCNYN |
| A0A1B7WNZ9 | 2-80 | NQDITGYNPSISKKIKTEQIEQIIKAIIGGKYSWACVLVLQFSGYNPTDYIPYRTYIRLLKTNRLLGNSEQNQPPMAKV |
| A0A0M1JZE3 | 1-83 | None |
| A0A3M2GAS1 | 3-86 | None |
| K9RPE6 | 2-64 | None |
| A0A6M0BI67 | 27-96 | None |
| A0A7C3KBX6 | 1-65 | None |
| A0A7H0F0E4 | 5-82 | None |
| A0A0N8KNR1 | 2-87 | None |
| A0A350XCD1 | 1-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.