DPCstruct | MC9100
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 112 ± 12 aa |
| Standard deviation of domain lengths | 11.51 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06253 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497AUT4 | 35-149 | EQPVTIGLINSFSPLGYSGEMLQALMEYARWRQPVIIAALAMAGSTGPITLAGVLAMQTAELLAGIALTQLISPGAPAIFGSTSTNI… |
| A0A7C4NCM4 | 58-168 | NYSMRVNHGDSLYDISRRTIPASGLPVGYMTMASCAFSGPVTLAGNLVVGNAEVISALALMQLAHPGAPVYYAAAQTAMDLRTGGYT… |
| A0A0E2NWW1 | 50-165 | None |
| A0A847T3E2 | 28-143 | None |
| A0A2M8Q864 | 3-111 | None |
| A0A538IUJ3 | 327-438 | None |
| A0A7C3DZ33 | 190-338 | None |
| A0A535P582 | 221-325 | None |
| A0A1W9WNL2 | 206-315 | None |
| A0A7V5C7G1 | 11-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.