DPCstruct | MC910
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 112 ± 10 aa |
| Standard deviation of domain lengths | 9.94 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U9S6C9 | 2-114 | GMIRFFVSPLIKGQNPVWFNSVTMSGGYSEFVQDGIQYRIAETDNVEMFADRTLYLAVNDGTFFAPDAYCFDEATGEITRNEGYEGV… |
| A0A3B8S6V7 | 12-122 | EPFFVSPLIKGLKPWQYNIATMNGGYQDFVEDGIMYRLMECNNVEMFADRGIYLCVSDTTFYSVDAYDYDELTGEIAPNSEYAGINV… |
| A0A645FPW3 | 2-102 | None |
| A0A239IHD4 | 165-278 | None |
| A0A1D8GI91 | 160-271 | None |
| A0A1M7TGV0 | 46-155 | None |
| A0A1M6TAW7 | 141-260 | None |
| A0A1M5TWE1 | 117-246 | None |
| N2BM84 | 159-284 | None |
| V8FXA4 | 98-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.