DPCstruct | MC91
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 80 ± 5 aa |
| Standard deviation of domain lengths | 5.10 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 28.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q5N2R9 | 199-283 | LAVSYEERSALLPTAVVYSKDRLGISAPNVREQYSGTAEHPVYQYSGLRLLVVSGGRIFLLNEGWTLRSGKVVVLRDDPGMRVEY |
| A0A2W2ECT2 | 1-90 | MLSGVVVYAPQRLHLEGAGVTETAFPDPHAKFRFRYTGLRLLLHAHGRYFLLPACWATSPEARAIALPDDTSLRLEFSLTITPPVCP… |
| A0A4R2GWU1 | 35-105 | None |
| A0A7Y6AGJ8 | 550-632 | None |
| A0A1Q9RWJ7 | 39-120 | None |
| A0A1H8Y806 | 88-167 | None |
| A0A5J6HQH5 | 119-198 | None |
| A0A428Z1S9 | 130-205 | None |
| A0A4R3RWQ6 | 304-389 | None |
| A0A8A3HN78 | 421-497 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.