DPCstruct | MC9098
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 69 ± 12 aa |
| Standard deviation of domain lengths | 12.18 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 25.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A191HVU6 | 6-73 | TYTITKSRRRRNLGVQVSNDGSVLVSAPSFLNQKEINAYLLEQEDWIESQLTIIEKRKKEEAEFIKEN |
| A0A3D5TG51 | 2-61 | REFTVIRSRRRTMALQVTREGQVVVRAPIYAARGDIHRFVTEHEAWIAAQQARQSQRLAE |
| A0A2E1NU00 | 47-96 | None |
| A0A1V1X1D5 | 1-91 | None |
| A0A1W1E7M4 | 3-82 | None |
| A0A2K9BLE8 | 3-67 | None |
| A0A1F5NRZ1 | 5-64 | None |
| A0A412KSV3 | 3-60 | None |
| A0A376RSQ1 | 2-66 | None |
| A0A101DJH7 | 1-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.