DPCstruct | MC9097
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 82 ± 9 aa |
| Standard deviation of domain lengths | 9.12 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.28 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | PF17650- PF17651 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A191HVE3 | 15-92 | EYGTSEITIVTSGDRIIALEEGNTANILYGIAFDIRTTSVVGSLIDLKTGEYIAVVSKENQQKEFGADVISRISYTLE |
| A0A110BJZ1 | 9-86 | VTGTVALVPGGYRLLNVDEGDTTGRLYGAAVDLGTTTVVAYIRSLTDGRVLATASNYNRQISCGEDILSRVNFARKSG |
| A0A3A6NCM9 | 2-95 | None |
| A0A1D2R5Y7 | 102-183 | None |
| T0D3G7 | 3-66 | None |
| A0A7C4LW28 | 1-84 | None |
| A0A1V5ZI31 | 110-182 | None |
| A0A0J1F617 | 82-155 | None |
| A0A838E6P8 | 7-88 | None |
| A0A2G8QZU3 | 2-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.