DPCstruct | MC9096
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 72 ± 4 aa |
| Standard deviation of domain lengths | 4.08 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 54.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0479 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N6XBL9 | 50-123 | FSAMQKQDILLHHPFESFAPVIQLLREAARDPQVLAIKQTLYRSGADSEIVQVLAEAARNGKEVTAVIELRARF |
| A0A191HT21 | 1-76 | MFFKWISEKDLVYHLPYDDFSAILAFINLAARDEKVLAIKQTLYRVSKNSPIIDALELAAKNGKNVTVLLELKARF |
| A0A2X2DE25 | 231-304 | None |
| U3U9B5 | 1-62 | None |
| C0FQJ9 | 263-334 | None |
| A0A644Y4R0 | 295-363 | None |
| A0A2I7CA36 | 72-145 | None |
| A0A0K8Q6J8 | 389-463 | None |
| A0A4Y1ZIT4 | 79-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.