DPCstruct | MC9090
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 268 ± 27 aa |
| Standard deviation of domain lengths | 27.39 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8EW74 | 378-632 | RDIMCYPGRILMKTGCEPIFKITRDLAFILSLGMTTELVHDINKPLSFLKLVRGRFTVYLKRILNIQWANVTVTSSVFLANSICEEK… |
| A0A8B6E8D4 | 215-456 | RNIMCYPGRVLTSDGCVPLLQTTRNLGYIVSLGLTSELASDIIGTVPFLKSVKTGFRKYLKSLLDIRKVNFTSSIYWANPNCAENII… |
| A0A6J8EWC8 | 28-349 | None |
| V4ADT7 | 255-544 | None |
| A0A6J8ET96 | 71-312 | None |
| A0A6J8EBN0 | 590-845 | None |
| A0A8B6EDI4 | 582-884 | None |
| A0A6J8CSD1 | 374-626 | None |
| A0A2C9LNX3 | 249-538 | None |
| A0A6J8C9Q7 | 492-749 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.