DPCstruct | MC909
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 64 ± 5 aa |
| Standard deviation of domain lengths | 4.69 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C8XGB4 | 16-72 | VRGQQLAEAMPDRCPNGHPLGTDTVLIGNHPCVACTGTGHRTWRCRECDACWIWPAC |
| A0A0Q7N9A6 | 7-72 | LYLRNGRWTEPAPRYCPNGHRLGPGQVLIGAVPCIRIGGHHRTHTCRACLTTTYTPPLHADCDHYS |
| A0A5M3YBZ4 | 1-68 | None |
| A0A1Y0CG08 | 31-91 | None |
| A0A5R8NE93 | 23-95 | None |
| A0A3A4K2Q4 | 247-316 | None |
| A0A0C1B371 | 25-88 | None |
| U5EQT6 | 40-100 | None |
| A0A5A7XPG7 | 8-69 | None |
| E9T0P2 | 9-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.