DPCstruct | MC9089
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 151 ± 11 aa |
| Standard deviation of domain lengths | 11.30 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 72.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821IMQ5 | 2-162 | VELVTTCCKFLSYFCRTSRHNQRAMFEHLSYLLENSSMLLSRPSLRGSAPLDVASASVMDNNELALALRESHLEKIASYLSRCGTTR… |
| A0A2C9M0R9 | 13-141 | AEMVVMCCRFLCYFCRTSRQNQAAMFEHLSYLLDNSSMLLARPSLRGSCPLDVAYSSLMDNNELALALRESHLEKIAVYLSRCGVQV… |
| A0A815S657 | 206-368 | None |
| A0A6J0XIR1 | 612-739 | None |
| H3CEU6 | 107-272 | None |
| A0A183R0D2 | 507-657 | None |
| A0A437BYE0 | 279-438 | None |
| T1GUW0 | 206-338 | None |
| A0A819YXF2 | 543-703 | None |
| A0A6I9YKS9 | 77-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.