DPCstruct | MC9088
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 229 ± 15 aa |
| Standard deviation of domain lengths | 14.88 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J7Q424 | 1-196 | MESKKHIYHLWVQYTTKNEEHFFRQFVMGFVSIWKSQLDLDWSRIPDWLAVKHDSGPLLSRLPEELLPAIGKFMYLAKEETEKESLN… |
| A0A2C9LXF8 | 5-229 | SHIPTMFTKWKSYLTSGETSQLLQFLEEYIHLFGHFLDLEFQQLSEGLYNESPPSLTQHPESLLDHLGREILKCSCDLARDIQQDSL… |
| A0A6I9N5S9 | 9-245 | None |
| A0A6P4FPS9 | 1-241 | None |
| C9QP04 | 1-255 | None |
| A0A6G0HI09 | 1-226 | None |
| A0A4Z2CE58 | 12-248 | None |
| A0A6J1VKK0 | 9-225 | None |
| Q6ZS30 | 1-226 | None |
| A0A6J8AWX3 | 1-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.