DPCstruct | MC9086
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 127 ± 17 aa |
| Standard deviation of domain lengths | 16.51 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.18 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | CL0001- CL0293 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1QXH9 | 2-132 | AFEKYMKSVRNSDIRTHSGPSMNPESFILSEWTTTIGNDLVAVDRNGLPLDYVISTTSLPELSKSLVMDVVQNVRNATSSYFKHNTY… |
| A0A814TFC9 | 39-174 | EVQEKHTSTLGGDTSITTIENWSATVPSNPVIIKLGIRSIFDLLNHGRFPNDSLIQNKSALIAQALNNYIVNPVYCYNNCTDHGSCV… |
| A0A3M0JAS4 | 74-202 | None |
| A0A815P650 | 1-121 | None |
| A0A820I9W0 | 1-118 | None |
| A0A814MAL9 | 3-129 | None |
| A0A819VA34 | 179-307 | None |
| A0A815HJ07 | 1-116 | None |
| A0A815I8E7 | 45-180 | None |
| A0A183T541 | 1-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.