DPCstruct | MC9085
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 112 ± 10 aa |
| Standard deviation of domain lengths | 10.22 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 24.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17517 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4QAY0 | 162-264 | PTHALSKTYIISAYRETANFQAQSLTPYADIIGVFDKTRVTFHIGGNNATTVRTIDDKKWRPYDVLRADLNRGDFWLIASEGPQSDI… |
| A0A2C9LU59 | 1-113 | MLLFPVSRFGHNYYVITPAGKPSFIIVASYNNTSVSVRLVNAGLASQPILANGRNYTNNDLMDLLLNSEQGFMIQRCNHHGSEDFTG… |
| A0A7M7SZU4 | 111-218 | None |
| A0A1S3JI19 | 988-1094 | None |
| A0A8B6DSU9 | 161-278 | None |
| A0A7J5XV15 | 58-164 | None |
| K1R6G4 | 79-193 | None |
| A0A6J8B5L8 | 86-186 | None |
| A0A2T7PUB8 | 113-229 | None |
| A0A2R2MU59 | 96-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.