DPCstruct | MC9084
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 211 ± 21 aa |
| Standard deviation of domain lengths | 21.03 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 69.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I8VFS9 | 293-513 | SDYDAEKENYLPFSEGERLTLVRYIGKGWYLGENSDNVTGLVPINFFEHVNIYEGVQQAADDESEEEAVKSPKGCVLKFASKLMWNK… |
| A0A2C9LP71 | 2-224 | DDYEGEEDGDLSFKEGEVLVILDTSREDGWWKARNEKGDIGMVPSTYLKKLPEEPEQASEGEEEMSGEDEVDHSTAPRTKRGRKLWR… |
| A0A0H3YFE3 | 450-681 | None |
| K1Q770 | 569-746 | None |
| S7PF46 | 3-192 | None |
| A0A1A8MGR0 | 167-397 | None |
| A0A1I7UFT7 | 174-357 | None |
| A0A6P8IED0 | 195-419 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.