DPCstruct | MC9082
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 124 ± 7 aa |
| Standard deviation of domain lengths | 7.36 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 74.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04790 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6P996 | 9-107 | MIMLLVMMMMMRMMMMMMMMMMMMMMMMMMMIMLLDGMGNLRITEKGLKLEGPSEFLKPLYAKEIQSKPGRPLFLQSSRNVSVNVVN… |
| A0A2C9LKP8 | 7-127 | NGGLDLNSPPPPPPQPVGIYGWRKRCLYAFVLALMIVVIMNLALTVWILRILRFSLDGMGHLKIKPSGIQVKAEAEFLKTVYVDELK… |
| B4I9I0 | 94-227 | None |
| A0A7R9Q8G4 | 47-182 | None |
| A0A2A2KF66 | 29-150 | None |
| A0A6F9CJJ7 | 16-139 | None |
| A0A6P5BH19 | 39-171 | None |
| A0A7R9QAX8 | 29-151 | None |
| T1JQS3 | 65-189 | None |
| A0A5S6CF37 | 4-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.