DPCstruct | MC9081
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 209 ± 38 aa |
| Standard deviation of domain lengths | 37.55 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 28.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K0E9R7 | 12-164 | DKKKETHLRCERQRREAINNGYNELRELLPKSMSSLGCKTTNASILFRSSDYIQQLTGKLENQEEELSKLRSKVAALQMIASEYENL… |
| A0A2C9LJP9 | 129-329 | SSTGSIPTAGCTSSASSAQNTDDEDSESSKVPTYKDRRREAHTVAEQKRRDAIKKGYDELQCIVPTCQQQDTLGSQKISKATVLQRS… |
| A0A7D9HH10 | 882-1100 | None |
| A0A182ES56 | 1-135 | None |
| A0A3P7IKA4 | 2-229 | None |
| A0A0X3P0Y4 | 929-1218 | None |
| A0A369SEI9 | 45-223 | None |
| A0A2C9JYW5 | 19-216 | None |
| A0A7M5WZP2 | 9-189 | None |
| A0A819NSS8 | 45-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.