DPCstruct | MC908
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 190 ± 22 aa |
| Standard deviation of domain lengths | 22.04 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838JI24 | 1-192 | MTSNLSPLSPGSLECWQMPVVPEQYDRKPLTDEERWALEHFAAGPLKPTGSRKTAKARQILARFNSPIADVFFLRHQGRSLTEVAEV… |
| A0A5R1M790 | 16-210 | SLPALLWDIRPEISESELAALDTLVDHFQQGGKNWSPDIQKRLSRLLLPLRDTLTKMHAAKAPYNSSIHDIVLEMQRIRKTYWAWTQ… |
| A0A4R7QP85 | 1-188 | None |
| A0A3E0CUP5 | 57-236 | None |
| A0A535VP30 | 4-192 | None |
| Q0RW12 | 129-341 | None |
| A0A4Q6WRC7 | 2-142 | None |
| A0A2P7AQG6 | 6-163 | None |
| A0A376W303 | 2-158 | None |
| A0A7W7H2V6 | 17-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.