DPCstruct | MC9078
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 94 ± 10 aa |
| Standard deviation of domain lengths | 10.02 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 46.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0375 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C9LIP4 | 1-97 | MEYRETEYNTDLTKVHHTNYVRNSRAIVVLWAIFTCIFFILNVVVWIQPQWIGDTGDSAVAGFFGLYKYCVETSVGSDFICNGDFIS… |
| A0A340WVG7 | 5-92 | QEASKLYHEHYMRNSRAIGVLWAIFTICFAIINVVVFIQPYWVGDSVSTPKPGYFGLFHYCVGSGLAGRELTCRGSFTDFSTIPSGAF |
| A0A815N1E6 | 1-94 | None |
| A0A7J5ZG06 | 1-103 | None |
| T1FMH8 | 1-93 | None |
| A0A3B5M190 | 5-93 | None |
| A0A4W5RLC0 | 5-92 | None |
| A0A401QDQ3 | 5-87 | None |
| A0A226MEN5 | 8-90 | None |
| A0A553P0M0 | 1-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.