DPCstruct | MC9076
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 195 ± 15 aa |
| Standard deviation of domain lengths | 14.92 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0111 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V2WVS8 | 173-374 | ATVLAALLAYETWGSFSGAAMTAGLFAILPAHLMRSMAGEYDNECIAMAAMLLTFYLWVRSLRNAGSWPIGVLTGLAYGYMVSTWGG… |
| A0A2C9LGK3 | 1-177 | MLAIVPGYISRSVAGSYDNEGIAIFCMLLTYALWIKSVKTGSIFWGALCALAYFYMVSSWGGYVFLINLIPLHVLMLMITGRFSHRI… |
| A0A2T7PF01 | 436-629 | None |
| A0A1Q9N6V3 | 137-333 | None |
| A0A7J6SI50 | 9-203 | None |
| A0A813FJU4 | 2-172 | None |
| A0A7J3NMC9 | 102-337 | None |
| A0A5N5QLV5 | 410-605 | None |
| A0A1Q9D9W9 | 561-721 | None |
| A0A7I8VU91 | 626-819 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.