DPCstruct | MC9075
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 188 ± 32 aa |
| Standard deviation of domain lengths | 31.76 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 52.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D0N616 | 3-189 | LVWWLFMGVFPLALQMRSYTQFVRPTRMSEILVVPQAQQVETANLTDFCPVEAFVLAGVWWNFEPTHYYTTDNGTVCHAVIPQYNTH… |
| A0A6A4FD69 | 33-208 | LFLMWMSIGVAPLLLQARSYVRYVTPHKISKSLLPLEADVHETADLLDNCPVEGLFVAGIWWNVTPLYYFQAQDGKLCHFVVPQYNI… |
| W2GFP0 | 17-212 | None |
| W2YU19 | 519-729 | None |
| W2ZJC9 | 432-635 | None |
| D0N4Z7 | 1-178 | None |
| D0N2X7 | 2-179 | None |
| W2LFM1 | 35-241 | None |
| W2IJB1 | 222-487 | None |
| A0A662XNE3 | 21-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.