DPCstruct | MC9074
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 81 ± 11 aa |
| Standard deviation of domain lengths | 11.13 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 66.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.87 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 72.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4FAH5 | 43-122 | SDGSRRVYLCDRIRPERYPGNRLTCHQIWHEMWKNGEERPPPRVGRDIQMRPLGKKRRRGRREDGGSNEEAGQEGQDDTE |
| A0A6A3F8E7 | 59-142 | SDGTKRVYLCDRVRPDHYPGNTMTCHQIWHVKWKNGDERPRPRIGRDIQMRGLGKKRRRVADDDGGEEKTEEQEAGDTGVVQSD |
| A0A6A3HSQ5 | 185-258 | None |
| A0A6A3ML71 | 352-435 | None |
| A0A6G0L5L2 | 72-179 | None |
| A0A6A3Z212 | 111-180 | None |
| A0A6A4D3A9 | 709-782 | None |
| A0A6A3X6Y0 | 399-474 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.