DPCstruct | MC9073
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 78 ± 6 aa |
| Standard deviation of domain lengths | 6.05 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 51.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3KG65 | 49-131 | NEMIPLIINEKNEGRLQTIENIDVFCEKGNFEVDSSRTILEAGKKAGLAINFHAEELNQIGGAEMGAEIGARAMSHLEKVSDN |
| A0A6A4F3W6 | 1-81 | MNKQILAFVQAKEDGAISPELIDVFCEKGVFEHEDTRRILEASKKAGLEINFHGDEIHPMQYGTMAADLGARAILHCDMKC |
| A0A2H2IKR6 | 2-86 | None |
| A0A3R7SQF5 | 108-179 | None |
| A0A3P7JL07 | 13-85 | None |
| A0A822G2J3 | 60-148 | None |
| A0A2I0LUI2 | 815-886 | None |
| A0A6G0UIK2 | 173-245 | None |
| A0A6A3HHD6 | 97-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.