DPCstruct | MC9071
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 209 ± 19 aa |
| Standard deviation of domain lengths | 19.16 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833WBH4 | 2-198 | SAGSCTRNQTALTTDCNSLCPQGRPCIAYAAGDEGECSTVASTFGNCTADDFCAYECFATGPDDFAANGAIDFSVYTFFIPFSNEVE… |
| A0A6A4EPZ4 | 7-229 | WMLLLMLATLPLVLVTAQTCDAQSLTLSSSCGGVCDSYQPCLAYNVSDTTSCNSCVADAAGDCSFVCYNIYREEPADRSLFVFFITY… |
| A0A6A3SCS5 | 1-248 | None |
| A0A3R7FXW3 | 1-236 | None |
| D0NCF1 | 1-198 | None |
| A0A5D6YB43 | 69-279 | None |
| A0A5D6YAT1 | 8-205 | None |
| A0A5D6XWY6 | 4-210 | None |
| K3X7M2 | 8-182 | None |
| A0A662XXJ4 | 1-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.