DPCstruct | MC9070
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 104 ± 8 aa |
| Standard deviation of domain lengths | 8.10 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.86 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3HM62 | 1-89 | MSVRRETRSEAQAFMDRLDDVDTADRGRLAKEHREFLGGVRAMDADFSSARQRDKRLQAPRLPPMGKDAAYLAANKKRVDQIRRAVA… |
| A0A6A4DXV9 | 1-100 | MAAQRETRIEHDAFLSRLAGRSLEERQRLSADHRAYLDGTRDVDADFGPAEQAPRTETPTVAVTPAVAATPATPRARAAPPLPPRGK… |
| H3GTL2 | 1-104 | None |
| A0A6A3QW88 | 1-110 | None |
| W2ZXY4 | 1-115 | None |
| A0A080ZGU4 | 3-105 | None |
| A0A080YZ85 | 1-111 | None |
| A0A662XDG9 | 1-110 | None |
| W2NYZ9 | 1-88 | None |
| A0A6A3JHL0 | 9-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.