DPCstruct | MC907
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 157 ± 18 aa |
| Standard deviation of domain lengths | 18.30 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 26.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G7DZA5 | 148-321 | ARTAALGLFPERIDASPYHPDYDEPGEQRPADDTFWARLRWCVEQGEAALLEEMYAHNASRWHRLTGGAIDTVRAALAPRALLAGWP… |
| A0A838JH40 | 1-165 | MDPIATTVTEFAVPIRNLLAQDQELLVLCRYANRGGNAYDWWLIRTDAELHTILATAPFQASISVFLEPELPLRGIANPTLLERALQ… |
| A0A401YR34 | 107-281 | None |
| A0A397QZX8 | 40-193 | None |
| A0A3E0HBN8 | 123-284 | None |
| A0A1E7MVL9 | 1-187 | None |
| A0A7W7HKA1 | 179-323 | None |
| A0A1V0A891 | 3-128 | None |
| A0A6G9GXE7 | 61-190 | None |
| H5XE83 | 11-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.