DPCstruct | MC9068
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 474 ± 101 aa |
| Standard deviation of domain lengths | 100.96 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 48.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4DQZ9 | 2-568 | WVDPETPVESSRWESSRGDLWELVMSDEFNLPGRSFRPGDDHMWTSIEKPDGVNDAMEVYAHNKTTTACEEASGVCSFQIEVEDSVT… |
| A0A6G0NJI0 | 3-375 | QSWNKFCYQGGMVEARVQLPGVVTPDSGNPDLAKGKNSKVSATKYYPTWPGIWMMGNLGRAIFSASTNRMWPFSYDKCEPDLFNTSY… |
| A0A329RRP1 | 52-514 | None |
| A0A024GM81 | 1-577 | None |
| A0A396ZSW2 | 1-494 | None |
| A0A3F2RX64 | 40-504 | None |
| A0A3F2RIA4 | 42-431 | None |
| A0A418AXL5 | 483-1104 | None |
| D0NGS6 | 1-422 | None |
| D0MSF8 | 77-508 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.