DPCstruct | MC9065
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 76 ± 5 aa |
| Standard deviation of domain lengths | 5.04 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 55.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0368 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446LJQ6 | 40-117 | YDRTESLMFLAHFVGDVHQPLHCGHVDDLGGNTIKLRWYRRKSNLHHVWDSDVITQAMKDFYNRDQDTMIEAIQRNIT |
| A0A4U9KFE1 | 16-88 | FMVHLLGDAHQPMHVSRAEDLGGNKISVTFFGRGSNIHRVWDSDLVDNEKWSYTEYARVLDYEKHFFQTIYQF |
| A0A7I8KWN7 | 136-225 | None |
| K3XLI5 | 138-212 | None |
| A0A446LJM2 | 20-99 | None |
| A0A835KPM7 | 395-472 | None |
| A0A314YLD5 | 142-219 | None |
| M7Y8Z5 | 32-101 | None |
| A0A453DT71 | 75-153 | None |
| A0A453DT34 | 116-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.