DPCstruct | MC9063
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 144 ± 16 aa |
| Standard deviation of domain lengths | 15.73 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 93.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U9K3B2 | 7-149 | ADKRVYIDPKESPRHFIDLDKIENTDSLLIPWYKVREKFNEKIILSKGIVPWQIDNSYRQLVKAFYNKDIARIIKLSADLGHYAADA… |
| R9GMD0 | 24-182 | HAVDPDKRRYTDPNEGPTHFLDTEHYGPSPFDSIPEKWTDAVLKYSADTLLKYGTVPWKIEKTYYALVKAFQQRDSLAILRLSANLG… |
| A0A519UPB8 | 3-146 | None |
| A0A2E7B0N2 | 57-163 | None |
| A0A2V7XKA1 | 22-180 | None |
| A0A523D172 | 26-170 | None |
| A0A2P8G889 | 76-206 | None |
| A0A815H059 | 61-206 | None |
| A0A2W5TSE0 | 58-214 | None |
| A0A2E1FPJ6 | 1-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.