DPCstruct | MC9062
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 64 ± 3 aa |
| Standard deviation of domain lengths | 2.72 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 91.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 51.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H4NCI2 | 48-113 | EAAAKVRSPVIVQFSNGGAAFIAGKGVKTDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCA |
| A0A4U9K0E1 | 1-66 | METAKKVNSPVIIQLSNGGAQFYAGKSLNNDNLQACILGAVSAAQHVHLLAEHYGVAVNFAHGPCC |
| A0A149SVU4 | 62-125 | None |
| A0A4S4LJU6 | 47-110 | None |
| A0A7S4BTC3 | 74-138 | None |
| A0A0C3DSA9 | 7-63 | None |
| A0A812WZ47 | 6-69 | None |
| D5G5V6 | 40-103 | None |
| A0A815WM08 | 47-111 | None |
| A0A0L6UHK0 | 114-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.