DPCstruct | MC9060
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 151 ± 14 aa |
| Standard deviation of domain lengths | 13.96 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A519ZGV9 | 1-117 | MKIPPVYKDYLDAIVRYYKQEKTTPDFSNRLLNPTSANLRDECLTVFLEGPAARDMKALKTFFEAQREDEIHRKIESIDIDKFKPLG… |
| A0A4U9JSG7 | 17-145 | EEVLATYWGKHQENKLHGKLANPTPANLRDYALYLINDDMDAEDKKSLRDFFGSKEDFSDLERAISGFDIDKLKPVQYFINKKTSQP… |
| A0A520J6K4 | 1-132 | None |
| A0A4Q5TXR1 | 2-144 | None |
| A0A1M3E4A6 | 3-150 | None |
| A0A1M3E499 | 1-145 | None |
| A0A088F3N2 | 3-161 | None |
| A0A0M3C8A0 | 5-143 | None |
| A0A2S1LKL8 | 15-177 | None |
| A0A167F0X9 | 2-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.