DPCstruct | MC906
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 226 ± 38 aa |
| Standard deviation of domain lengths | 38.08 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.87 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0413- PF11796 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A9WBG5 | 375-625 | RPELALLWRAVHARLSSGRPVSRVTVGPLDVDARQALADLLGLDRLPRPRATVTLARLDEALRDSVGADARAVVEAILGPLGDRAAD… |
| A0A838JG25 | 38-242 | QRAIDFFRKADLDRLLVKLREKYIEQGQVGGQIQLIECTPRERRDIASFLGKTPYRYTVIKLKLSEMDAALQKSGFHCTLPELLEAF… |
| A0A353M049 | 8-273 | None |
| A0A8A9AM09 | 1-194 | None |
| A0A4V1ZHD1 | 153-451 | None |
| A0A4S8Q9R5 | 12-198 | None |
| A0A015LUT3 | 6-226 | None |
| A0A373J3V3 | 1-187 | None |
| F6G7H5 | 130-386 | None |
| A0A3N6ILR7 | 9-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.