DPCstruct | MC9059
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 207 ± 17 aa |
| Standard deviation of domain lengths | 16.94 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q6RN13 | 3-200 | ATEGIRYTDSLSYLAISKSDLSVKEKRDMAYSVYNFGLLYQTGEMTNPDPKLFELKACYTIDKKEHPEYEQKKEYIDGLNDGDFVTG… |
| A0A4U9JN45 | 1-202 | MSYHAIENLVESTILIIERSHLSIEEQRNLIYNLYQFQNRFDTSYTTLRCFSFLEKIGYIKKLPVDQHPDYKSDSEYFASIEENWIP… |
| D7IPK0 | 1-212 | None |
| A0A1B2I5A1 | 1-237 | None |
| A0A3S1D068 | 1-213 | None |
| G1UZZ4 | 1-198 | None |
| A0A2W5V0W5 | 1-180 | None |
| A0A7T8B9S0 | 1-231 | None |
| A0A443ZKU4 | 1-187 | None |
| A0A4R1EU15 | 1-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.