DPCstruct | MC9056
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 146 ± 12 aa |
| Standard deviation of domain lengths | 11.60 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A416R1M0 | 1-130 | MYEQKCPNCGGNKIVFENGKYRCTYCDTVFSERIADKATYKYAARISQAGEHLKMKNYDRAYTIAKDLSDIHPTDPDPYTIMLLSIT… |
| A0A7U9WVQ3 | 7-143 | VPLCPMCGGVLKIESGATSVKCKWCRNTVLVFEAKKQGRISVDGIPTLADRIDSGYTFLNIGDYERAFEAFDYAIQIAPNNYRVWWG… |
| A0A7C6XTN5 | 3-155 | None |
| A0A1G4VI14 | 1-139 | None |
| A0A1H7PS71 | 2-143 | None |
| A0A349BYE4 | 1-167 | None |
| A0A316RZT2 | 1-151 | None |
| A0A3A8YR30 | 3-163 | None |
| A0A374EEP0 | 1-153 | None |
| A0A1Q2MFC3 | 1-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.