DPCstruct | MC9055
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 149 ± 15 aa |
| Standard deviation of domain lengths | 15.21 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U9SZ92 | 18-163 | DVSEMTLDEYKRYLCNKISDLPVSDSARLNTHGVLILKEEAFVSMQKDPAYEKKIMNMLRKGFQTQYPFYSPNIGYQVIGGSEKECY… |
| A0A175A6T6 | 2-156 | ELFKKEFYEDLSKITNHRTVSNAAVNISEEAFKAMKDDPQYREKVLSLIQRDWGDSYAPRNCSVLITVGATLNEYRADSWPVGYDSE… |
| A0A1I5E7M3 | 104-290 | None |
| A0A1C5XZ78 | 2-129 | None |
| A0A318EQH0 | 39-180 | None |
| K1UZI9 | 61-203 | None |
| A0A0M6W9J3 | 75-218 | None |
| K1RVW8 | 1-134 | None |
| A0A417UC19 | 118-270 | None |
| A0A6L5YK92 | 45-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.