DPCstruct | MC9052
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 125 ± 11 aa |
| Standard deviation of domain lengths | 10.80 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 24.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E7GTR8 | 17-144 | LEIQTGACSFCGQMGQIETLIPWDQEKVNEAVTELCDCYGAKEYARKKGQKERACKAIEGQFGQQADTEEADEPIRNLLKHIAELIV… |
| A0A7U9SP78 | 6-131 | QTAPCRFCGQMVQFEGDSDLTDPQKQETATMTCTCPEAVEYQKEKQRKEKALKNVSVLFGEDAAPEKRIGEGIVSILRAAVEEIYSG… |
| A0A2S0L5N7 | 1-116 | None |
| A0A174U8V7 | 44-184 | None |
| A0A3D2D5N4 | 22-165 | None |
| A0A2V2GNH1 | 419-547 | None |
| A0A1Y4I878 | 130-248 | None |
| A0A3R6ARM8 | 2-109 | None |
| A0A1I3J1Z8 | 75-199 | None |
| A0A415Y8D1 | 13-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.