DPCstruct | MC9050
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 105 ± 12 aa |
| Standard deviation of domain lengths | 12.42 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 23.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S0E034 | 168-249 | LAPADLAVLVAEGDPLSEAVGAAYLAARGVPAANLIKVKLGTASDSLSVAEFAALKADVDARLPAGVQATLLTWARPSRVVG |
| A0A840V7D4 | 4-109 | HLIAFFCSAASVFGALNPDQVVILFNRNAADSDTLAKHYAELRDIPATQIVGLDLPDKEQIDRDEYRTQLRDPLAKIFDDRRWWLRN… |
| A0A1Q2HQQ7 | 1-103 | None |
| A0A7C5BV29 | 4-113 | None |
| A0A7V2CKW0 | 1-133 | None |
| A0A820Z0B6 | 81-168 | None |
| A0A538AM51 | 26-141 | None |
| A0A251W8R6 | 6-122 | None |
| A0A497HT53 | 46-149 | None |
| A0A2T5IKM9 | 14-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.