DPCstruct | MC905
Metacluster Properties and Pfam Annotations
| Number of structural domains | 89 |
|---|---|
| Mean domain length (aa) | 149 ± 23 aa |
| Standard deviation of domain lengths | 22.67 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06210 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G1S707 | 11-131 | SRHAPEDVNAKHRQRLKFHDKVAVLITSAIGSMYALYFFIIFVFGWMLWQSVSPKPFDPFPYIFMIFISNIVQLLLLPLIMVGQNIQ… |
| A0A838JCZ8 | 2-146 | YKHHYAIINVNDAHNEKLTVGQKVADAIATGMGSWSFIIIQSLILAAWIILNLVAWVNHWDPYPFIFLNLTLSFQAAYAAPFILMSQ… |
| A0A7X1FQH1 | 61-201 | None |
| A0A101PM10 | 1-126 | None |
| A0A7T5CK87 | 91-250 | None |
| A0A2G9NQQ6 | 3-124 | None |
| A0A4Y8M290 | 1-145 | None |
| G2KTH3 | 44-204 | None |
| A0A0P9CLH8 | 42-157 | None |
| A0A3D0I815 | 146-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.