DPCstruct | MC9047
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 154 ± 22 aa |
| Standard deviation of domain lengths | 21.98 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A844MHE6 | 3-156 | YTTKFSGKFQLDHPLFDFQALYLLDFARTRRVKRSQSILMIIPDPGREAVGLPLGEEGGYFINESHPQAAESVMDENRPPKGQPGLY… |
| A0A6J4XNZ3 | 40-183 | IGYSTDFQGELKFKNELTASQIAHLKKFLGEDRRDIDFADDAKVYKSDKEYWYHIDLEFNDDFSGLRWNGSEKTYSLPEIVNFLTEQ… |
| A0A0F9BFZ4 | 1-158 | None |
| A0A017TA08 | 1-162 | None |
| A0A229SDR1 | 1-168 | None |
| A0A6G7YBY6 | 6-137 | None |
| A0A496WBE0 | 1-136 | None |
| A0A450ZT64 | 1-135 | None |
| A0A450ZGS9 | 1-133 | None |
| A0A0F7FD75 | 5-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.